PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02131.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 342aa    MW: 37407.9 Da    PI: 5.6708
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02131.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.99.9e-091958340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                             +r C+ +++  +  fC+ ++ +lC  C +++H    H++v
  Rsa1.0_02131.1_g00001.1 19 ARSCDACKSASAAVFCRVDSAFLCIACDTSIHTFtrHERV 58
                             578*****************************55778875 PP

2zf-B_box25.52.8e-0860103542
                 zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                               C+ +e+ ++   C+ +   lC  C + +H+       H++vp+
  Rsa1.0_02131.1_g00001.1  60 LCEVCEQAPAAVTCKADAASLCVACDSDIHSAnplasrHERVPV 103
                              6*****************************66999999999986 PP

3CCT70.15.8e-24274317144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Rsa1.0_02131.1_g00001.1 274 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 317
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.951760IPR000315B-box-type zinc finger
SMARTSM003367.5E-81760IPR000315B-box-type zinc finger
PfamPF006433.7E-72058IPR000315B-box-type zinc finger
CDDcd000212.25E-82058No hitNo description
PROSITE profilePS5011910.63756103IPR000315B-box-type zinc finger
PfamPF006433.3E-660103IPR000315B-box-type zinc finger
CDDcd000211.20E-860103No hitNo description
SMARTSM003362.3E-961103IPR000315B-box-type zinc finger
PfamPF062035.2E-18274316IPR010402CCT domain
PROSITE profilePS5101716.817274316IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGFGLESIKS LSGGWGAAAR SCDACKSASA AVFCRVDSAF LCIACDTSIH TFTRHERVYL  60
CEVCEQAPAA VTCKADAASL CVACDSDIHS ANPLASRHER VPVEPFFDSA AAKISPSTFG  120
VLGSSTTVDL TAVPVMGSAD ELDLCPWLLP NDFNEPAKIE TGTELKSSEF VFSDFDRLID  180
FEYPNTFGAD SLVPVQTKTE PLPLTNNEHC FDIDFCRSKL STFTYPTQSI SHSVSTSSLE  240
YGVVPDGTTS VPFNRSTITT STATTGDQPS SMDREARVLR YREKRKNRKF EKTIRYASRK  300
AYAESRPRIK GRFAKRTEAE NDDVFFSQVY ASAGHYGVVP TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU9497980.0KU949798.1 Raphanus sativus var. raphanistroides isolate Rs-1 CONSTANS-like zinc finger protein 5 (COL5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621617.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A078J4C80.0A0A078J4C8_BRANA; BnaA02g35200D protein
STRINGBra020425.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5